SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780772|ref|YP_006545245.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780772|ref|YP_006545245.1|
Domain Number 1 Region: 198-277
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000317
Family MarR-like transcriptional regulators 0.05
Further Details:      
 
Domain Number 2 Region: 133-204
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000969
Family ArsR-like transcriptional regulators 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397780772|ref|YP_006545245.1|
Sequence length 309
Comment hypothetical protein BN140_1606 [Methanoculleus bourgensis MS2]
Sequence
MAVRDLRGQGDRHPGLHNTNVLTVEDRNVELLFRRRSSMARWSRVFSFLLVAVTLAALLL
PGTATARYVVEPVTEEYTGEWHDLEEITFWDLPPRVMTLYFLLTVLPGLPYMGELFYALS
LLLPLGFRRVMRHNVLDDDFRRDLYRQITTNPGAGTTELRDLTGASRGRLRYHLDVLIRE
GKVAAVDYRNRARHFARNQRYTALEKRIIANLRDETPGAILAHLLRSPGATRNEIAEDLG
LSGPTVSQHMQQFEAEGIVTADREERPFRYRLSAGARGFLNEHRDHPRPVGRSSTEGYPG
ARGHEVPSG
Download sequence
Identical sequences WP_014867503.1.51038 gi|397780772|ref|YP_006545245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]