SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780784|ref|YP_006545257.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780784|ref|YP_006545257.1|
Domain Number 1 Region: 185-253
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.39e-18
Family PF1790-like 0.051
Further Details:      
 
Domain Number 2 Region: 111-173
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000044
Family FaeA-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397780784|ref|YP_006545257.1|
Sequence length 265
Comment hypothetical protein BN140_1618 [Methanoculleus bourgensis MS2]
Sequence
MSSITTEGCRASVGGWTVHRAALLLIFLALLVLWSPAAAKIIVEPGPAELPTDGINVDDE
RFVPVWQAYSPLEFLTILLLIHCPLLAMPFEIICSAGVLAFLGYRTSRCPLDNKKRSRIY
ACIRDHPGITPTEIARATGINRGTTRYHLSRLREAGLVSAVNRDGRVGYFRRGYDATSKT
ICCHLRNNTRREILALLLDDPGITQSEIADDTGISRSAAAWHLQRLDADGLIESDRDGRA
VRYALTDEALEIFVVLERGDHGRAC
Download sequence
Identical sequences A0A0X3BMF6 I7KD70
WP_014867515.1.51038 WP_014867515.1.63524 gi|397780784|ref|YP_006545257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]