SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780842|ref|YP_006545315.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780842|ref|YP_006545315.1|
Domain Number 1 Region: 1-280
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 8.89e-118
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397780842|ref|YP_006545315.1|
Sequence length 280
Comment methylenetetrahydromethanopterin dehydrogenase [Methanoculleus bourgensis MS2]
Sequence
MVVKVGIAKLGNIASGVMAELLLDERADREDMITFMATSGTKLQPEDIDRVVSNMKAWAP
DFCIVVSPNGVLPGPTQAREDLAAAGIPCIVITDDVTTKKDQFAALKESDFGYIIMKADA
MIGARREFLDPIEMADYNGNLVKVLAITGAYRKMQLELDKVIDQVKAGKKGKDLVLPKVV
MTSDKAVDGEFSNPYALAKARAAYEIAQQVAAVNVKGCFMTKEWEKYIPIVASAHEMMRQ
AMILCEEARDLEKGMDAVIRKPHKKTGEIVSKTKLISKPE
Download sequence
Identical sequences A0A0X3BMI1 I7LMX2
WP_014867573.1.51038 WP_014867573.1.63524 WP_014867573.1.88179 gi|397780842|ref|YP_006545315.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]