SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780875|ref|YP_006545348.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780875|ref|YP_006545348.1|
Domain Number 1 Region: 207-474
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.06e-66
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000127
Further Details:      
 
Weak hits

Sequence:  gi|397780875|ref|YP_006545348.1|
Domain Number - Region: 2-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00666
Family MarR-like transcriptional regulators 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780875|ref|YP_006545348.1|
Sequence length 481
Comment phenylalanyl-tRNA synthetase subunit alpha [Methanoculleus bourgensis MS2]
Sequence
MELTLNEKRLLVALGPVGSADAATLADLMDTRREAVVQYANLAGERGLVDVEKHVSRRYT
LTGEGRGYAGKGLPERQVLESFENEIPMRDLQAHPLAKIAIGWMRKKGWVVVRNGVVQKT
GNAAPGPDEAAFARASENGAITDGEGVADLLRRGLVQEEEAVTYTVSITPGGRELLAGGL
DLQEEVGTLTRDQILSGAWKDLPLRRYDVGKLPKRAYPGKTHPYQRLLDEMRRVLLDMGF
TEIAGGIVQSSFWNFDALFQPQDHPAREMQDTFFLGERWPLPAGYERVRDMHEYGGETSS
TGWGGTWNAAKAEQCVLRTHTTSLSIQYLAEHPKPPVKAFCIGRVYRREATDPTHLAEFE
QLEGVVMDDEVNFRHLLGFLKEFYRKMGFEKVRFRPGYFPYTEPSVEPEVYVDGLGWVEL
GGAGIFRQEVTAPFGIEHPVLAWGLGISRVAMLRLGLRDLRHLYRSDVEWIRDTPTYGRR
R
Download sequence
Identical sequences I7LK53
gi|397780875|ref|YP_006545348.1| WP_014867606.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]