SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780923|ref|YP_006545396.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780923|ref|YP_006545396.1|
Domain Number 1 Region: 345-618
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 2.67e-72
Family TroA-like 0.0015
Further Details:      
 
Domain Number 2 Region: 140-282
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.09e-26
Family Terpene synthases 0.012
Further Details:      
 
Domain Number 3 Region: 23-198
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.00000000000143
Family Terpene synthases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780923|ref|YP_006545396.1|
Sequence length 656
Comment prenyltransferase/squalene oxidase [Methanoculleus bourgensis MS2]
Sequence
MKHGISILLILLLCIASCVAYPMDPGDPAIQASLDYLRDCQKSDGGFGEAGRESSPGTSS
WTIMAAVAAGEDPRGWVKNGNSTIDYLRSMNDDILAKGGTVDIARTILTLVAVEEDPRAL
CGTDYVAELKSRVKPSGQAGDHVFTTIWTIIALASVGEETDASAAWLASQQNADGGFPWT
PGAESDPDDTGAALEALAAAGISHDAAAVQNALAYLKGMQQEDGGFHYGGTSATNSASDS
WVIQGIVAAGGNPAEWRADKTSVVDHLIGLQNPDGSFRHTTYVTDNPCGMTASAVPALLG
KPYPVTPSETLPLSPATPAPHVTTTAPTATPARTPAPAATGTGGGTVTVTDDFGETVTIR
GIPQRIVSLAPSNTEILYDLGLEDRIVGITDYCNYPPAAADKPKVGGYSTISIERVLAAD
PDLVFAALGNTEDVVNRLRSLGMTVVSLNPETINDVLHDIELVGAATGQEEQAAACVKEL
RARIQAVTEKTEGLTEKPSVAHVIWYDPIWVSGKGTFQDEVITMTGGVNAFGSVEGWSII
GLEEFLTSDPEYILVSSGTGMGEGGYDIVYDYFMNEPRMQQLDAVRNGHVYVIDADIISR
GSPRIVDALEEVAGDLHPDLFGTSVPDTTPVAQSPGFGVIALICAFFAVFLIRVKR
Download sequence
Identical sequences I7L057
WP_014867654.1.51038 gi|397780923|ref|YP_006545396.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]