SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397780950|ref|YP_006545423.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397780950|ref|YP_006545423.1|
Domain Number 1 Region: 55-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.88e-29
Family iota-carrageenase 0.047
Further Details:      
 
Domain Number 2 Region: 800-856
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000209
Family Type I dockerin domain 0.0033
Further Details:      
 
Domain Number 3 Region: 372-522
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000236
Family Galacturonase 0.047
Further Details:      
 
Weak hits

Sequence:  gi|397780950|ref|YP_006545423.1|
Domain Number - Region: 548-611
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0977
Family Transglutaminase, two C-terminal domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397780950|ref|YP_006545423.1|
Sequence length 860
Comment hypothetical protein BN140_1784 [Methanoculleus bourgensis MS2]
Sequence
MRDRRTTKLLIAVFLIIGLVPIVGALETTPTTIVVAAKDSSAADKASAAYVCDGVNDHVE
IQAALNALPSSGGVVLLTSGTYNCAGIIAPKAGSTLKGEGESETYLKFTHDGRINVDREY
VTLDGFNIQGSGYSSGVKWLGVMTVRASHAKIHNITGTADASIQAVFLLIHDPTVYAPTL
QDIEFTNCKAVDTGTYGFLHNAWGTTNKVIKDVRYENCAAINCGKFGVFNPWITGFDFAE
LNDIEGLRVKNCLAEGNLESGFHFEFDPKKVDCVLENCVSRNNGQKPYPTKAYNPNDMST
HYFGCGYYAPNADVTFINCVAEGNSMNGFYTTNGGKLYNCVEKSTAIGRTNFAYRAPAGY
YSVPCRSVNPSLVMENCTSIDSHGYGLQVDLANNVKIRNFHLENPAGINGKGSSLGGTNG
QFDNAEVSIYASGNRVETLVWAKENENTVFSGQIVSDAAKPFLIEGYGTRNVLVKDMEIV
SKTLPAGSPGVTIAGTVPAGQATLRNVKVTSTGSPVSTPTPTVPGPTPEPTTPAPSGKPD
LVVTDISWDPASPAPGSAVTLSATIKNQGSAPTPAGVKHGVLFTFDDGAAGPGVWSDTHT
GSIAPGAWVTVTANGGSAGAAWKAVAGTHTVKAHVDDVNRIAESDEANNVHTEQITVTEA
ATPTPTPTTPAPSGKPDLVVTDISWDPASPAPGSAVTFSATIKNQGSAPTPAGVKHGVLF
TFDDGAAGPGVWSDTHTASIAPGASVTLTASGGSAGATWKAASGTHTVKAHVDDVNRIAE
SDENNNVLRKEIVVGTRPAPVKGDLNGDGSVDWADVTIAAEMAQGKLKPTTAADLDGDGT
VGWKDVALLADFFFGRTASL
Download sequence
Identical sequences I7LK78
WP_014867681.1.51038 gi|397780950|ref|YP_006545423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]