SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781116|ref|YP_006545589.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397781116|ref|YP_006545589.1|
Domain Number - Region: 92-130
Classification Level Classification E-value
Superfamily GAF domain-like 0.0216
Family IclR ligand-binding domain-like 0.026
Further Details:      
 
Domain Number - Region: 33-118
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0463
Family Sensory domain of two-component sensor kinase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781116|ref|YP_006545589.1|
Sequence length 158
Comment hypothetical protein BN140_1950 [Methanoculleus bourgensis MS2]
Sequence
MIGKPYSRLNMMKGMDMAMEQYIISASSRARDLAPVMMCVHDLLGHLPVTARSRDHPGIR
IEDGKVIDEAYTGPILEEVLAENVVKRVRPPGGPYMGIPVVVAPVRDGEGRAIGAIGIVD
VTGIFDLASFMEQSAEIRRQVCGRDPCPLPTESPAAKR
Download sequence
Identical sequences I7J9X1
gi|397781116|ref|YP_006545589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]