SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781152|ref|YP_006545624.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397781152|ref|YP_006545624.1|
Domain Number - Region: 241-274
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000545
Family Penicillinase repressor 0.069
Further Details:      
 
Domain Number - Region: 50-133
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.00365
Family Hypothetical protein VC1899 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397781152|ref|YP_006545624.1|
Sequence length 280
Comment hypothetical protein BN140_1985 [Methanoculleus bourgensis MS2]
Sequence
MAGMEKIVHIIPLGHEYDRAVKPFEDSNADRVYILTRWHDPSAALKMVNDQRYYALKVRD
ALIKKGIDVKCESVNLFDFLEVTKSISKIIVREKTEGNRIRMNMSAAGRLTSVAATLVGM
HHDVQVYYVHADGYPDDPGEQKEHGLSVCDSNEITYLTNLKFDMPDPIGVNILAFLCEKG
KKVNTRDLLGKLKDLQVEGFQELFYDNIDLVDNDKRKNSQQGVISAKRTLQSRQLMKLNK
TILEKLERKGYIKREKIGRSLYVSNTDTGKYVAYLSGLVE
Download sequence
Identical sequences A0A0X3BNS3 I7LN87
WP_014867882.1.51038 WP_014867882.1.63524 gi|397781152|ref|YP_006545624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]