SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781153|ref|YP_006545626.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781153|ref|YP_006545626.1|
Domain Number 1 Region: 164-247
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000473
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.04
Further Details:      
 
Domain Number 2 Region: 82-146
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000106
Family Z-DNA binding domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781153|ref|YP_006545626.1|
Sequence length 255
Comment nucleotidyltransferase/DNA-binding domain-containing protein [Methanoculleus bourgensis MS2]
Sequence
MLSSAALAYRVNESQILCFFCNHLPDQPEPPGTAAGAREWVALSRCPRMFPIRKHFVSRA
ETFSSRGSNNMGKPVLTELFKTEERIRILRYVAGQRQVTTTAVAGASGTSKPLVSRYLRL
LVKGGFCTQRGRAYTWNENARSLAVKRLLNIDLLAAAVPLPEWARGIGIYGSYAGGTNTA
DSDLDLWVLVDEYTPDLEILAARVEKDASAAAGTETNLLILTPERLSDLRETDQLFYTSL
IRSSVTLGGASIDNA
Download sequence
Identical sequences I7L0K6
WP_014867883.1.51038 gi|397781153|ref|YP_006545626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]