SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781225|ref|YP_006545698.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781225|ref|YP_006545698.1|
Domain Number 1 Region: 136-260
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-27
Family N-terminal PAS domain of Pas kinase 0.051
Further Details:      
 
Domain Number 2 Region: 625-767
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.47e-26
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 3 Region: 259-384
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-24
Family Heme-binding PAS domain 0.024
Further Details:      
 
Domain Number 4 Region: 416-554
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000214
Family GAF domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|397781225|ref|YP_006545698.1|
Domain Number - Region: 14-114
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000131
Family Heme-binding PAS domain 0.028
Further Details:      
 
Domain Number - Region: 547-607
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0667
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781225|ref|YP_006545698.1|
Sequence length 774
Comment Sporulation kinase A [Methanoculleus bourgensis MS2]
Sequence
MHEYILAHGDIPALSAILDALDEGVLIIGPENRVACINRHLQRFLDINQDTPCGVDADLV
IRRDLVPRICEESRGKEILAFLSGRLETVEFVCTLRSPDGEVEQARCSCRTVHEGPLPGT
RLIHICPDRRRSGAPERRRMEEILRESENRYRFLIENLNEGIWMIDARGTTVFANQKMAD
ILGYPVADMIGMPVSAFVAEEDVGAVQERLRRRERGMREVFECEFLQKSGARVHTLVATA
PIIDADGTLRGSLAGVLDITPQKIMEEQLRESEEKYRSLVELSAEATLIYRDGRIAYVNP
AGMRLLGASNPAEVIGKAIIEIFRPEARDRVGDLIVQDLQGEETPLVELPLVRLDGTTVP
VEGRGTRTFLEGRPAVQIVMRDITHRKRAEEQLQASNRHLLLLNRIIGTSTTHSTGELLE
TALDQTLDLLGYDSGAIYCPDAARGRRTPYCRRNIPDGCLERAESTLGEFWAGRPCYLER
GGDRDTAPLLRETGLAALACIPLAAESEVFGALLIGSRDRGSFSPGERALLEAIGREIGA
GLLRRVLLHRLEAANREANLYLDILTHDIRNADNVANIYADILIDELEGEAALHARKLKD
GIRKSIEITTNVATIRKIHESRAGFAPVDLHAVILDEITHFPDLCIHYDGQPVEVFADDL
LPEVFMNLIGNAVKHGGPGVEVTVAVEDRDERTVVVTVADTGPGVDDEAKKAIFFRFERE
SGRRGSQGLGLSICRMLIARYGGNIWVEDRVPGHPEEGAAFRFTLRKAGCCGRR
Download sequence
Identical sequences I7LKH6
gi|397781225|ref|YP_006545698.1| WP_014867955.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]