SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781231|ref|YP_006545704.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781231|ref|YP_006545704.1|
Domain Number 1 Region: 285-411
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.68e-22
Family Heme-binding PAS domain 0.052
Further Details:      
 
Domain Number 2 Region: 512-629
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-20
Family Histidine kinase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781231|ref|YP_006545704.1|
Sequence length 643
Comment multi-sensor signal transduction histidine kinase [Methanoculleus bourgensis MS2]
Sequence
MKSDLARTESLAEYPPRCGADLQQGRVEEGVAKSCIWTPFVAFTVLLVALAATSLYSYLL
FHTIAELVAVGIAIAVFTVVWNARTMRENSYLLVTGTGLLFVAGIGLLHTLAYKGMGIFV
GYDANLPTQLWIASRYLLAGTLLAAPLLFRSDLDRRWVFAGFAGVTGPLLLSIFVVPVFP
DCYVEGVGLTPFKVWSEYLISALLALGAVAFYRLRAAFSPRVAGHLIAAILVLIASELAF
TLYVSVYGIANQVGHLLMVLSFGLIYIAFVETGIRQPYAVLFTGLVASEERLRREKDRLR
QYLDIAGALFVVLDADGRVSLINRRTSEVLGYPADVVVGEPWIERFTPPEERERLQTLFC
RLMRGDTEPVYARTSVLTADGGERIIQWHNTVLRDGDGAVWGTLSSGEDITEWQYAEAAL
GRANAKLNLLSAITRHDILNQITVARAYIDFAAEGSGDPGIRDYLDRARIAVGEIQKQIE
FSRDYQDMGMMAPAWQRPEDLIRESASELVLPVGVRVLTDLAGLEVYADPMVQKVFHNLI
DNAVRHGGAVTEVRFSWMRSGQDLVIICEDDGIGIPDSEKAAIFRATYKRRHGHGLFLVA
EILGITGISIQETGVFGEGARFEITVPNGAYRFGEGLRPVGSP
Download sequence
Identical sequences I7JA79
gi|397781231|ref|YP_006545704.1| WP_014867961.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]