SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781232|ref|YP_006545705.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781232|ref|YP_006545705.1|
Domain Number 1 Region: 117-327
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.1e-23
Family Plant O-methyltransferase, C-terminal domain 0.0068
Further Details:      
 
Domain Number 2 Region: 23-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000583
Family LexA repressor, N-terminal DNA-binding domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781232|ref|YP_006545705.1|
Sequence length 367
Comment Methyltransferase [Methanoculleus bourgensis MS2]
Sequence
MTNHTIQFWQGMPAAENVELLDATISGYQAYRVLSAALELGLFDWLSEHGPATRHDVAAL
GINGMFTRGFLAALADMGYITFDGGVCANTRITEELLVSTSPTYQGDLILAAGRETSSWS
DLAETLRNGVERPKTGPRPTHDHLRAVAQRCIRGELQHVVGLVARHPGFWDARSMLDIGG
GHGLYAIALCQENPDLQACVFDLPHVVPLTREYIDRYGMDGRVSARGGDILVDDPGRGYD
LIIVSHLLYKFRDRLTDVLGKVTESLAPGGLLVLNHLFCTPDCTVSPGAGVAELDRALMS
AGHPLCHPQGLEAVLKRLGYTGITTFPHETGMGYGVLFCATNGEGAGCCDDGGWTSGCSC
GPGGCGN
Download sequence
Identical sequences I7LND3
gi|397781232|ref|YP_006545705.1| WP_014867962.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]