SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781234|ref|YP_006545707.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781234|ref|YP_006545707.1|
Domain Number 1 Region: 20-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-52
Family Extended AAA-ATPase domain 0.000000658
Further Details:      
 
Domain Number 2 Region: 256-327
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-21
Family Helicase DNA-binding domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397781234|ref|YP_006545707.1|
Sequence length 331
Comment Holliday junction DNA helicase RuvB [Methanoculleus bourgensis MS2]
Sequence
MTKRITSPATLPEEVDDATIRPARFDEFVGQPQVKETLAIAIAAAKKRGESLDHILFSGP
PGLGKTTLARIIAREMGVAIRTTTGPVLDRPGDLAAQLTALNRGDVLFIDEIHRLNPVVE
EILYPAMEDSCIDVMIGEGPGARSVQLPLEEFTLVGATTKVGLLGSPLRDRFGFIFRLNL
YEVGDLAAIVQRSAGIMQTPITPEGALEIAKRSRGTPRIANRLLRRVRDFALVRGDGSID
GETADLALTMLGIDQLGLDDLDRRILSVIAYDFGGGPVGVKTIAISVGEEVRTVEEVYEP
YLIQIGFIKRTPQGRETTAAAEEHIRTTPRE
Download sequence
Identical sequences I7KDL5
gi|397781234|ref|YP_006545707.1| WP_014867964.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]