SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781241|ref|YP_006545714.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781241|ref|YP_006545714.1|
Domain Number 1 Region: 3-243
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.77e-31
Family Extended AAA-ATPase domain 0.0055
Further Details:      
 
Domain Number 2 Region: 242-321
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000415
Family TrmB-like 0.085
Further Details:      
 
Domain Number 3 Region: 344-407
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0000965
Family MRR-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781241|ref|YP_006545714.1|
Sequence length 466
Comment hypothetical protein BN140_2075 [Methanoculleus bourgensis MS2]
Sequence
MSTFIDRDRELSHLHERYRSDRAEFVVLYGRRRVGKSELIDQFLRTATGIHLVAREESKH
LQLRRFSADLSAYFKDSFLQKTGFSDWDSFFEYLIQHADDRIVVAIDEFPYLIKEDPSLP
SMLQDYWDRRLKETRIVLILSGSSISMMESATMEYGSPLFGRRTGQILLQPLRFIHVLEY
LGDMKKAVEFYAVFGGTPAYIMAVDPERDIMKNIEEKVMREDSFLFRDVEFVLRAELVEP
RYYFSILFSLAGGNHRIGLICNDTGLSKSVVNKYLSILIDLKLVHRRIPVTEGHRSRKGL
YFLSDNLFDFWFSFVNPHLDMLERGNAPLVVDQYVRPQFARYVGKHFEEMVMDLLVHING
DGFLPFVFTRIGSWWHRGEEIDIVCLAENPHRILFCECKWQDGVDAAEVFAGLRRKAPLV
SWHNDRRSEYFCVVARSFSRRAEGEGISLDLDDCAALMERGRRGRE
Download sequence
Identical sequences A0A0X3BP28 I7JA86
WP_014867971.1.51038 WP_014867971.1.63524 gi|397781241|ref|YP_006545714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]