SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397781303|ref|YP_006545776.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397781303|ref|YP_006545776.1|
Domain Number - Region: 692-904
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00235
Family DPP6 N-terminal domain-like 0.037
Further Details:      
 
Domain Number - Region: 468-549
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0252
Family I set domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397781303|ref|YP_006545776.1|
Sequence length 1013
Comment hypothetical protein BN140_2137 [Methanoculleus bourgensis MS2]
Sequence
MISERTAFPMVVIMVLLAALVVAPAAARVDINTLEPGDTVYVGEENLNFGPAFGPEPVTK
LVHFSDPPSGQIDRMIVVSPPFELTRSDFGTTTGTYYAFNQTADVITPENAAGHIFINIP
SVTLDVVLNASRMDSVDGKSVTRDNVLDFKVLNNLVGFAGVAGAPTMNIEVTLPGGGVTA
QFGGLDLRSIPADGTTMHLGGIDLRDAAAGIYTAQAKWPATSDFYGKGFDSNTVVFGVVI
RDLSISANKDVVTRSKSFTVTITGEAKKDYRLFVRDVEGLTRGEYPVITPGQPGIRDYSP
TDVTVTTNAAGTRSIQFDTNQSTGDWRFTICVEDPDKPGTYDEVEVRVTKGSVTITAAGT
GVYAIGEEITLSGTCTESDTVYLFLTGPNLPTNGAALLDVTAPVEDGKTVTFTRVDVEAD
DTWSYKWNTANVGQNLDAGGYTIYAVSEPRRKDNLIDARFATTSIQLRPPSLTVRTSGTT
LTRGDDYQIAGTATGDPDSVRIWIFGPNCQKLGVLVLVESDGSFEYTLTGAETSDLMKGQ
YYVIIQHPVTNGFDVIADGTMISGPGIVSVDLSRLQASDAAMALTNALDSPNVDDVYIKV
TFTVADSWIRIDGIGDQIYGETFTVTGTTPYPTGTALTYQITAKEDGVTVLSGETVVAEN
GDWSFEVDTVVIGPGVFTIRVMSLDSQVSTTALFDVYDDMLHPVTPPGATYQIESIRVNP
PLNELSPGESLTLAGTINAPRLGHQGCLEFSTDLEDPVWSYSLERDGAVIYSGSRNSRSF
TLSAFELDYGQDIRILLSLNGIVPQGAEDQALLRILERDAEGRIVPESEYRLSFTPSGGT
PPSTDLTLHSGWNFISVPRPLVAGNDTALIFTSVETGGRSIFRYDTAAGEWVALAETDQI
APLEGFWIYSTKPSTVPLNFSTDPLISPAKRSLSTGWSAIGITGTAPATARDALLSVNRE
WTTLIGFDAGKQAFETGIVNGGSNDYTDSRLVYQGKGYWLYMTEPGTLCAIGV
Download sequence
Identical sequences I7L0V1
WP_014868033.1.51038 gi|397781303|ref|YP_006545776.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]