SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781305|ref|YP_006545778.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781305|ref|YP_006545778.1|
Domain Number 1 Region: 118-388
Classification Level Classification E-value
Superfamily Subtilisin-like 9.43e-94
Family Subtilases 0.000000472
Further Details:      
 
Domain Number 2 Region: 623-709
Classification Level Classification E-value
Superfamily E set domains 0.000000612
Family E-set domains of sugar-utilizing enzymes 0.031
Further Details:      
 
Domain Number 3 Region: 714-773
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000128
Family Type I dockerin domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781305|ref|YP_006545778.1|
Sequence length 775
Comment hypothetical protein BN140_2139 [Methanoculleus bourgensis MS2]
Sequence
MQYPERKQFSLRFIAVLTLIAFCITSASADPGQHERIIIGFQEGSVQTLDDADLSSLDVR
VIDELTGLDAVVVSVSDPDRFMEEVSQCPGVKFVERDIPVYALDVPAYVPDDRRYAEQWG
PGGIGADYAWSIERGESSVIIAVIDTGVDYTHPDMGNYITGGYDWINNDDDPMDDHGHGT
HCAGIAAAVSNNALGVAGISQSGIMAEKVLDFKGSGTSSLTAAAIRHAADNGADVISMSL
GAAEPSRIVEEACRYAWEKGCILVAASGNGGANLINYPAAYDIVIAVGSVGKTGLRSPFS
NYGTNLELVAPGESILSTTPGNTYGLRSGTSMACPHVAGVAALLLSRYPGMSNLEVRKRL
TETADDLGSPGKDPQYGYGLVNVFAALGGGEAVPPTIESDAEAIVRGENITLTLTGEGYR
EYRLSINDTGLTDPGMYPMVVPDQQGILPGEISGSAGFDETACRVIMPESGTARVRYATG
FSTVAQPFTVTVTDPKDPSLSDTINVSVNPGTVTITAGDRARFFFGEEVTLSGINTDNES
TWLYMTGPGLDAGGAGLADPGMVRVPVTGDGNWSFVWDTGALEGVLENGTYTLYAVSGPK
AADELEGFASATASLELLNSGWPAPAITGISPDMVFAGDGSATVLITGSGFFDGATVLLE
REGYRDVIATEVRGNDTNTVSATLDLTAARTGGWDVVVRNADGKTALLPGAFTIWVKGDL
NNNDLVDIGDAALVAYMVVGNVPEDLLADFNQNGVVDIGDAAKVAYVVVGRISEL
Download sequence
Identical sequences I7LKK4
gi|397781305|ref|YP_006545778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]