SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781306|ref|YP_006545779.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781306|ref|YP_006545779.1|
Domain Number 1 Region: 11-127
Classification Level Classification E-value
Superfamily PKD domain 8.76e-29
Family PKD domain 0.00052
Further Details:      
 
Domain Number 2 Region: 124-184
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000054
Family Type I dockerin domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397781306|ref|YP_006545779.1|
Sequence length 186
Comment carbohydrate binding family 6 [Methanoculleus bourgensis MS2]
Sequence
MGYRYLRPPPGGGTYTIYAVATPNARDDLADAVYGTASVTLRGEPGPTAGFTANTTAGPA
PLAVRFTDASTGEITARSWSFGDGNTSSERDPVHTYRAPGNYTVNLTVSTGSSSDTLSQP
GYITVTVKGDFGGDGEVDIGDVSRVAYMVVGKTAVDPAADFNGNGAVDIGDAAKIAYYFV
EKIEAL
Download sequence
Identical sequences I7JAC7
gi|397781306|ref|YP_006545779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]