SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781307|ref|YP_006545780.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781307|ref|YP_006545780.1|
Domain Number 1 Region: 1395-1641
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 5.62e-44
Family Serum paraoxonase/arylesterase 1, PON1 0.058
Further Details:      
 
Domain Number 2 Region: 1631-1861
Classification Level Classification E-value
Superfamily NHL repeat 6.28e-43
Family NHL repeat 0.00013
Further Details:      
 
Domain Number 3 Region: 1831-1933
Classification Level Classification E-value
Superfamily PKD domain 1.44e-28
Family PKD domain 0.00037
Further Details:      
 
Domain Number 4 Region: 1173-1281
Classification Level Classification E-value
Superfamily PKD domain 2.88e-26
Family PKD domain 0.00059
Further Details:      
 
Domain Number 5 Region: 73-154
Classification Level Classification E-value
Superfamily PKD domain 1.16e-24
Family PKD domain 0.00055
Further Details:      
 
Domain Number 6 Region: 987-1074
Classification Level Classification E-value
Superfamily PKD domain 4.05e-16
Family PKD domain 0.002
Further Details:      
 
Domain Number 7 Region: 1304-1406
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000000000157
Family Serum paraoxonase/arylesterase 1, PON1 0.067
Further Details:      
 
Domain Number 8 Region: 2-68
Classification Level Classification E-value
Superfamily Kelch motif 0.000000183
Family Kelch motif 0.014
Further Details:      
 
Domain Number 9 Region: 1936-1994
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000706
Family Type I dockerin domain 0.0043
Further Details:      
 
Domain Number 10 Region: 1083-1177
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000000957
Family Cellulose-binding domain family III 0.014
Further Details:      
 
Weak hits

Sequence:  gi|397781307|ref|YP_006545780.1|
Domain Number - Region: 838-892
Classification Level Classification E-value
Superfamily E set domains 0.0257
Family Filamin repeat (rod domain) 0.0091
Further Details:      
 
Domain Number - Region: 182-251
Classification Level Classification E-value
Superfamily PKD domain 0.0471
Family PKD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781307|ref|YP_006545780.1|
Sequence length 1996
Comment Tripartite motif-containing protein 71 [Methanoculleus bourgensis MS2]
Sequence
MGGRSGGSKNDVWRSTDNGATWTQVAADAGWSARHEHSSVALPDGSIILIGGEHSSNFGY
LNDVWRFESPLAFSYLNALFGSDTETGTAPLTVRFTDTSTGSPTSWSWDFGDGETSTDQN
PVHIYKNPGEYDVSLTVKRGSASDSITKAGLIIVNEPNAGLNIDLEYRNSIQFNSMDPVE
VRVRTTDSNGMPKASTITMMGTGEASVKVHATEYTYSFVPEHSGTYRVAVIAVSDDGIEL
SKRVTIEVIDDLSFAKKRADDLKSLANTEIDQAERMAAERSVDLAKDMFLDNLLDAEGVS
STITVFFDGASLLVTDVFRSTVGDLSGEYARYFCGYLKNQVEGKCSDMMGDAIFGDDDSY
LVNSASTGIENLCKVKERRDALDQTTENFVGYIEANPDQFRDNDQVNAYINMYSSGIKSA
VETHDVVHVTIWSRSFGYSYPEAYYLYDTFSKNSKIMKLALGTAIGVGAVVAVTTGVGAT
VVAALIPATMTIIKSVSSFDTFASVALSILLVSNVPIIADDVVHEHQNSISGIERALSGT
SADFVALSVSDVSAGETASITSSGDVFIIRPSGRVETILLGGGHYTPTGSGIYKAYSYNH
GNGLFSQIEGCDIAVKVPDVEVNATYTTAGDLASIRVMAENHEDSSIDDMYLTTSVSDSD
GNLIHLYDEPFDLGPLQNATYEYEMDAPELNTFYVAETILSVNYSTVLDSVSFIIETEGS
NEAEKAVILSVDSPQVFLYGKDIYINLTIRSFKDALPITLEIPEFKYSTTEYITGEEVVQ
VVLPGQEPDDYIAPIYLYGSDGSTCDADVIRFTVQAEGTGFLSIEAGDALFPAGEIITIP
LVFTDAALNNLDGEVFVQVRTPENEDIDATVTGSNGNYQFSFTPPVSGTYSAIAEAYKDG
YYVYGDQVTFISGEMSPLELGVGADEENLYVNVTANGLPVNANVTMTSNGTEIAKTAVSG
IAAFPKEGSYRLTAEMLFFTPTEFSHMTPEARLSLENNRTIPDRAVVFNASASHDPDGWI
AEYRWDFGDGHQETTTSGYTLHPFNATGYYTVNLTVVDNDGLGSSVTRDIIVIERSTPAF
DISEKSIYVNYTGDVSIQATDLDEISWLRMVIEFDPNIVEGIDVAEGDITLIPSSIANGG
VIIESGAIESLSGSANLASITLKGVNEGCTTINITAVCRDVDGCLIRPIASGNTIQVLSG
TPLLANFTTSNSIGTAPLAVQFTDTSIGDPTAWIWDFGDNGTSNEQHPVHTYKTAGNYTV
SLTAKNADYSNTILKQDYITIKEPPAYAFVKSWGSGGSSDVESFSYPTGIATDATGNVYV
ADYSNHCIRVFNSTGDYVATWGSYGFWNGQFDRPTGIATDISGNVYVSDYYNHRIQKFDS
TGAFLTTWGAYGTGNGQFDKPWGIAVDAAGDIYVADYNNHRIQKFDSAGTFVTAWGSKGS
GSGQFNGPICIAVDAAGYIYVSDDYNNRVQKFDSAGTFITAWGSEGTDSGQFSSLVGIAV
DSAGHVFVVDHLNCRIQKFDSSGTFISTWGSKGSSDGQLNNPSDIAIDTAGNIYVADTYN
NRVQKFDKSGNFMRRWESWHTGEIKFLYPAGIATDTVGDIYVADYYNHRVQKFDSSGALI
SMWGSYGSGNGQFDRLTGIATDISGNVYVSDYYNHRIQKFDSTGAFLTTWGAYGTGNGQF
DKPWGIAVDTAGDIYVADYNNHRIQKFDSAGTFITAWGSEGSGSGQFNGPICIAVDAAGY
IYVSDDYNNRVQKFDSAGTFITAWGSEGTDSGQFSSLVGIAVDSAGHVFVVDHLNCRIQK
FDSSGTFISTWGSEGFSDGQFYRPSGIALDSAGNVYVADTYSNRIQKFSPSPTKLPVANF
SANKVSGPAPLTVHFIDTSADYPSAWLWDFGDGTSSIEQNPVHTYLAYGNYTVKLTVSNI
FGADSLSKEGFIFAKRVKGDFNGNGAVDIGDVARVAYMVVGKEPADLAADFNENGAVDIG
DAAKIAYYFVGKIGEL
Download sequence
Identical sequences WP_014868037.1.51038 gi|397781307|ref|YP_006545780.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]