SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781308|ref|YP_006545781.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781308|ref|YP_006545781.1|
Domain Number 1 Region: 1178-1272
Classification Level Classification E-value
Superfamily PKD domain 1.57e-30
Family PKD domain 0.00024
Further Details:      
 
Domain Number 2 Region: 828-914
Classification Level Classification E-value
Superfamily PKD domain 2.88e-28
Family PKD domain 0.00029
Further Details:      
 
Domain Number 3 Region: 1269-1329
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000209
Family Type I dockerin domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781308|ref|YP_006545781.1|
Sequence length 1331
Comment carbohydrate binding family 6 [Methanoculleus bourgensis MS2]
Sequence
MTFPIERRSSTIAAIPTSGHPDTPTPLLRFPFSTPGQAGARRQDRCRGCVVMMKQILSLV
VLIVLAALLPAAAADTGTGGASPDSLEIGDGANNRLLSLGFIPNVGQYDPGVDYVLHYQD
TTVFFMRDGLVLAHTAGSAENVSRDVIRQSFAGASPETHLAARDQRAGVVNYYVGNDSSK
WLSGIPVYSEVVYEDLYPGIDLVYAEKNGRLKREFRISPGADPSQIELLYEGESEPYVDG
DGVLRFASPAGEMLESPLVCWQVIGGEKVDRVAEYVVDDGSVRIAVAEYDAGHELIVDPE
LVYSSYLGGGEGDYGYALAGDGDGGVWVTGYTASPDFPVLDDSDGKSGHTAFVSHFASNG
TLLSSTCLGGARSLGGTRSDYGHVLAGDDEGGVWVIGTTGSDFPVLNASQSAYGGDGDVF
VSHFSSSGTLLSSTYLGGGGIELDNALVGDGDGGVWVAGLTTSTDLPVTEDAYQSTYGGG
SGDAFVSHFSSTGALLSSTYLGGENYDYGSALAGDGAGGVWVMGGNQYGGFPVLNEYQRT
NSGGWDVFVSHFSSSGTLLSSTYLGGSDHDDGSALVGDGDGGVWVTGETLSLYVPDSSKG
FPVRNASQRTNGGGYFDAFVSHLSSEGALLSSTYLGGDEHDSGYALAGDGDGGVWVTGRT
RSADFPVRNAHQSAYGGGFSYGDRFVSHFSSEGALLSSTYLGGEADDCDGDKGREDDHRY
TLVGDDAGGVWVTGSTASTAFPVLDEYQSTNGGGWDAFVSHFASDGALLLSTSLGGDGDD
HGRALAGDGHGGVWVTGYTGSPGFPVLNAYQSSYGGSSDVFVAKFGIDDPVPVHPPTANF
TANVTAGPAPLAVRFTDTSTGEITAWSWDFGDGNTSSERDRVHTYTTPGTYTVALTVSNS
HAEDTMRMEHYIQVQKPLPSAELIFNVNYNRGTSNDSIASGTSPCSLAYYTSVHNPQENQ
ESILGDLVFVLDAQEIVSVSSGTCAEINGTQVTWTIPSPAAISPGTGSSTSAATSATADQ
SSGVTLERSCNRTVFTEAGVQQVTLNITFDTIDLDNLWGRIMCTETDDVRPTIVPGTIST
DLPLRGLSEERAGVYFGVNQSAIETGRQYTLSCAVEVDPLRPVAFAPACAIWEVRNSTSV
AAPAGTAVTIPAELLPGNVSSVAFSSATPCEWTCIQNEHIITSLYQRAVPAPSANFTADV
TSGPAPLAVRFTDASTGEITAWSWSFGDGNTSTEQNPVHTYTAPGNYTVNLTVSTEDGSD
TLSQPGYITVTVKGDFNGNNEVDIGDVARVAYMVVGKTAADPAADFNGNGVVDIGDAAKI
AYYFVEKIEAL
Download sequence
Identical sequences I7L0V3
gi|397781308|ref|YP_006545781.1| WP_014868038.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]