SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781311|ref|YP_006545784.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397781311|ref|YP_006545784.1|
Domain Number - Region: 27-148
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00391
Family Cellulose-binding domain family III 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781311|ref|YP_006545784.1|
Sequence length 1043
Comment PKD domain-containing protein [Methanoculleus bourgensis MS2]
Sequence
MKSRHGRQLAMFMVLLSLLCAGVVAQEVEISSVSNVKMNTTANLDLTIQHSSKDLGTVDI
TLKYDPSVMKVTRFNLNSDLWASLGGTVQPGLIGIAVYGSDGVAAAPVNAQSPVSIGSFV
VESMFNDGSQTPLELVLTTVTDYDGSKITGEFAGGVKNGSFSTLDETPPTITIDYPRDTA
TVSQDIMVNATITDVGGVNPDSIKVYVGNTAVNFTKKLIPQGFIINATHTVQNLGQHVIC
VEASDKSGRSNNSSITVDVQLSGITITYPTANDQFINNSRPAISASFVEVDNTTVRMFLD
GKDVTGNCTIDEQLGTITLGYGTDCLDDKKYEVVVSGTSSLTHSPVSSNASFVIDTKPPT
VTITKIIDGDGDGYKEAGEYLYVYYTADDANLGDVWFDYGCNTTGEKNGFLVANITAGNK
EEVAYAVDRAGNVGNSTPVHIYNNNLVYFNDSSLGSFAGLDLTKTALYDVFSTARAFTLY
GPDAWMTAPKIGELKKSITGGSNVIIDCRKNDPIRAGSLPSSVGIYTTPTGTLDFAVKVP
NVTNATLMIARANSTLIDQLIKNPSKDALTPGMLKDLLDSKKIVLYGKEGYAIVNVDTRD
VKVNKGGSITVDLDDMSETIRINYVDLSTSTGFNTKNMPYGSTPLQISDLGQGEYALLAV
CMDDDRFAIVAGTTFEVTNQAGLLSTSAGTYTIGQPVVVNSAQKGEILSAVVLNSKATYT
GNVTLDFSTLGKETFKSAYLLADGNQTVVKPYGKANVWLTKGYGNTSAKKNTASVSVPTH
DLLPGEYRVYMFLEDNGNVTSYNEAIITLTTVTPTPTPYTPGRSSGGGSGSSYTSYTGTG
TLKVGSSGTVLRSIMVNAEDKVGSLFVPIGIKALDKDGNPLTGITLTPISSDEMPAVPSG
AAFKFAGYVYEASPEGATFDPGITLTFEIPEDAWRTLDPENNDFTVKWYNKETGQWEDVP
TTVYKSTRSVDAEITHFSIFALFTEPATTTTPTETETPATSTEPTTPPAGEAPAEGLPMT
MILAIFAVLVIIIAAGYFFMVRK
Download sequence
Identical sequences I7JAC9
gi|397781311|ref|YP_006545784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]