SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781335|ref|YP_006545808.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781335|ref|YP_006545808.1|
Domain Number 1 Region: 385-510
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.9e-27
Family Heme-binding PAS domain 0.018
Further Details:      
 
Domain Number 2 Region: 30-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.77e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.09
Further Details:      
 
Domain Number 3 Region: 509-643
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000011
Family Heme-binding PAS domain 0.077
Further Details:      
 
Domain Number 4 Region: 261-366
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000209
Family Heme-binding PAS domain 0.087
Further Details:      
 
Weak hits

Sequence:  gi|397781335|ref|YP_006545808.1|
Domain Number - Region: 653-710
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0745
Family Homodimeric domain of signal transducing histidine kinase 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781335|ref|YP_006545808.1|
Sequence length 730
Comment Sporulation kinase A [Methanoculleus bourgensis MS2]
Sequence
MHTMKESPHTKTPAPRDPDETGAIPPAVNESIPYGIWIAGPEGDVLHISDSFLDLIGMTI
DECRQPEWLRLLHPEDMGPVLADRARCIASGECWNREFRVLGTDGEYHTIQSRGMPIRND
EGEVLLWAGVNLDGQQKLQPRAPGRERQARRMEALSRISGVIAQGEGNLHEICRQVVAWM
PDGFRHPELISARIIIGRAVFITGDDNPRRIVAALPTERGVAGYLEVEYQGSLPQGTRDP
FKPQERNFVHTVAVMIGNVIAREETKAALKSLERQHRLLSDQVLESIFLLETVRDSAGEP
VDYRCIEINSRAEEEIGYGRDEVIGKMFFEFFPGTSPELRAMLCRVAKTGTPEHGEAHCR
KLDGYYEVRAYRPQCNQLALIVNDITIQKKTEEALRESEEKYRMLVETARDGILVHDTRT
FLYANPAAAALFGVERPEDLVGMSVIDRVHPDNRDQIRVRMSEVISGEIPPLRETQILRL
DGSAVPVESAVSPVTYSGKKMVQITMRDITRRKRYEAALRRNGERFRRIFNQSPIGIEYY
NLEGRLIYINRASLAIYGIPSRRDVIGYNLFRDPNTPAWARERFRRGDEMHCTTPVDLDL
ARRAGTYPTTRSGTIVIDVHASPVHDRKTGVLKGILMQLQDVTDRVRMEDQRQQAFYQIE
QNIEQFAILADRIRLPLQVILGTADLIDDDEASAKIREQVERVNSIVRQLDKGWIESREI
REFLRRNELV
Download sequence
Identical sequences I7LKL4
WP_014868065.1.51038 gi|397781335|ref|YP_006545808.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]