SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781342|ref|YP_006545815.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781342|ref|YP_006545815.1|
Domain Number 1 Region: 141-220
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000143
Family Kanamycin nucleotidyltransferase (KNTase), N-terminal domain 0.064
Further Details:      
 
Domain Number 2 Region: 48-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000835
Family MarR-like transcriptional regulators 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397781342|ref|YP_006545815.1|
Sequence length 221
Comment hypothetical protein BN140_2176 [Methanoculleus bourgensis MS2]
Sequence
MRESQHLLNNIQQNENPGRQFLDEETPTADGNTPPGNPHPWDFLDAYGSLFRRSSLILLV
LLGRDYTRKFHVRELSRIVHRDVSLVSKNLKDLGAMDLVTREDVGNLAFYQANMENVLLR
QMKISFTVLELQPLIRDLQGMTTSVILYGSCARGEDTPASDIDLYIETLDKEPIPEILHM
HQNTLARELSPIVNTPDETYRLKTEDAPFFDNIQQGIVLIG
Download sequence
Identical sequences A0A0X3BPV7 I7LNH6
gi|397781342|ref|YP_006545815.1| WP_014868072.1.51038 WP_014868072.1.63524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]