SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781399|ref|YP_006545872.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781399|ref|YP_006545872.1|
Domain Number 1 Region: 373-499
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.2e-21
Family Heme-binding PAS domain 0.024
Further Details:      
 
Domain Number 2 Region: 160-252
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000108
Family Flavin-binding PAS domain 0.057
Further Details:      
 
Domain Number 3 Region: 15-111
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000503
Family Heme-binding PAS domain 0.038
Further Details:      
 
Weak hits

Sequence:  gi|397781399|ref|YP_006545872.1|
Domain Number - Region: 328-387
Classification Level Classification E-value
Superfamily GAF domain-like 0.0216
Family GAF domain 0.029
Further Details:      
 
Domain Number - Region: 481-548
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 0.0711
Family Purine and uridine phosphorylases 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781399|ref|YP_006545872.1|
Sequence length 585
Comment PAS/PAC sensor protein [Methanoculleus bourgensis MS2]
Sequence
MTDSYHDRAPYGLPVLDALDDGLLVVGDDRRVAWCNTALARILDIGKEDAIGMDILALFS
RYLLPNLQNETSARLVVQALENGADLPPFICHTRAPDGIRRWLSISGIPAHADIGNGFRA
IRVRDVAGDANAHHFMTALDQSPVVVFAQDSDLRYIWSYNQQLGLTDTSILGMTDEEAFL
PDDAARLTALKRQVLETGETVRAEAALTVGNEVHIRDLTLKPFRDAGGRIVGITGTAFDV
TERDRVEEALRKRTYDLDQRMNELRCLYSITHLVEIPGITLDALLQAVADTLPSGWQYPG
DAAVRIMVDGREYWRGGPGETPWKQRSPIIVHGECAGEVEVRYLHEKPGAAEGPFLREER
MLLDAVAERLGRVIERLRAEAALQKSEEKFRGIAQRSFDIIITSYLADGLNYASPAVERI
LGYCPEEMTGTDLEDYILPSSLPAWEEGRQKVLRGEQVEGLRVEVRRKDGEAAILELNES
PIVEKGVIVGFQAVGRDISERILYERFREQAFDMTARNIAQFAVLADHVRHPLQVVMGIA
DLLDDEEAAEKLREQVRRINLRISQLDREWIESRKIREFLKRYEL
Download sequence
Identical sequences I7KDS7
WP_014868129.1.51038 gi|397781399|ref|YP_006545872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]