SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781420|ref|YP_006545893.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781420|ref|YP_006545893.1|
Domain Number 1 Region: 660-782
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.85e-24
Family Heme-binding PAS domain 0.027
Further Details:      
 
Domain Number 2 Region: 167-295
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.11e-17
Family Heme-binding PAS domain 0.035
Further Details:      
 
Domain Number 3 Region: 540-655
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000112
Family Heme-binding PAS domain 0.052
Further Details:      
 
Domain Number 4 Region: 48-144
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000995
Family Heme-binding PAS domain 0.016
Further Details:      
 
Domain Number 5 Region: 419-542
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000209
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.046
Further Details:      
 
Domain Number 6 Region: 293-406
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000553
Family Heme-binding PAS domain 0.057
Further Details:      
 
Weak hits

Sequence:  gi|397781420|ref|YP_006545893.1|
Domain Number - Region: 789-849
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0726
Family Homodimeric domain of signal transducing histidine kinase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781420|ref|YP_006545893.1|
Sequence length 869
Comment PAS/PAC sensor protein [Methanoculleus bourgensis MS2]
Sequence
MQENSLDQQIQAVRHCISELTLGMPAGPGDATPPGRLRRAAENLATAATRAEEERQQLRD
LLGSSPDGFVVTDTDGRIISANPAAVALLGESLPGTLLVAYGYPDTQPEIALMLADLRAG
RACAPRETTLRSRGGARVRVVITAAGRGAGEKRWLIRERPALQESEERDRLLARVEEERS
LLQAIIEQMPEGVVIAEAPSGRLIHYNEQLRRMWGRPDMPRDLRTFSGLHSDGRPYQPEE
WPIARSVASGEVVRDEEFRILRADGTWIYINASSAPIHDESGIVRYAVAVLSDVTDRKQM
EEELQASEEKYRKLFENTGDAINIFEMVRDEHGEIVDWILRDANPVSQRDLGRLDEIVGR
RVTELFGAEVMAEYITRSREIMASGVGQKYENSFWGNRYYISSTYPIGKDLIGSVSTEIT
DRKRMEEELHLQQQRLELALSAARMIAWDWEPAAGRLRISGDFEGIYGRPPFARPEERLA
LVHPDDIDRLRAEGEHSGPYHTEYRIIRPDTGAAVWLESRGEVQRDEAGGFVRAVGVTMD
ITGQKQSRQALEHQQELLQGIIDAIPVMITIYDPDLMFFRLNREFQRVLGWSEEDGARGD
LMTRFFPDPEYRKMADDYMRSLKPGWRDLLLVAKDGSIVETAWANIRLSDDTRVGIGIDI
RERTRAEAAIIESEERFRALMNASPNAVMLIDRDGTILILNEVAAERFGGSVQELMGTPV
YDYFTPEVAARRREIIEEVFSTGRPVRFDDEREGRVLYNSLFPVADAEGNVVRVAVLSYD
ITEQRRSEEMRHQAFAQIEHNMEQFAILGDHIRLPLQVILATSELLDDEQASERIRKQVW
RINDLVRQLDRGWVESREIREFLRRHELM
Download sequence
Identical sequences I7LKP3
gi|397781420|ref|YP_006545893.1| WP_014868150.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]