SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781470|ref|YP_006545943.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781470|ref|YP_006545943.1|
Domain Number 1 Region: 6-63
Classification Level Classification E-value
Superfamily Vng1086c-like 4.45e-18
Family Vng1086c-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397781470|ref|YP_006545943.1|
Sequence length 71
Comment hypothetical protein BN140_2304 [Methanoculleus bourgensis MS2]
Sequence
MLVRKLAKYCALKIDPSQVHKSKMEHKYAIFVLGTELANAMKDVEFSSSGRISARMRELA
EKTLKEIEYLQ
Download sequence
Identical sequences I7LKR1
gi|397781470|ref|YP_006545943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]