SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781625|ref|YP_006546098.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781625|ref|YP_006546098.1|
Domain Number 1 Region: 4-247
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.11e-32
Family Extended AAA-ATPase domain 0.012
Further Details:      
 
Domain Number 2 Region: 245-327
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000222
Family Transcriptional regulator IclR, N-terminal domain 0.066
Further Details:      
 
Weak hits

Sequence:  gi|397781625|ref|YP_006546098.1|
Domain Number - Region: 341-430
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0118
Family MRR-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781625|ref|YP_006546098.1|
Sequence length 458
Comment hypothetical protein BN140_2459 [Methanoculleus bourgensis MS2]
Sequence
MIREFVDREIEAALLEEEWQKAGGRLIILYGRRRIGKTRLITEFIRGKQGILHFAEDTAP
QVQIRRFQAAVAEFFGDSLLASLDLTSWGQIFSYLAQKPVPERRYLVIDEFTYLIKNDPA
ILSALQKAWDTALSGSNWCIILAGSMLGMMSDLALSSTSPIYGRRTRDILLGALRFPDAR
KMLPTFSFRDALRVHLTIGGIPEYLLKAGDYSDYTTFVGREFFNRYGYFYREPYFMLSQE
FRELRTYQAILNAIAVGKTAPGTIAQFCGMDTRHLYPYLEAMTRLGFIERELPLLGNRRQ
GLYRIADSIFDFWYNFVFSRRQAIETNGLAPDAVDLNPYFGKQFEAFVRDEFARVVFPGC
TTGRWWYRDAEIDLVAVDEKAGSVVFGECKWGGLSKMEARGVLARLEQKAGLVRHARYPA
ERFCLVSGGDIGGKDRLREEGFLVYDMTDIEAAFGGGG
Download sequence
Identical sequences I7LKW5
WP_014868353.1.51038 gi|397781625|ref|YP_006546098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]