SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781665|ref|YP_006546137.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781665|ref|YP_006546137.1|
Domain Number 1 Region: 133-260
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 3.6e-44
Family CTP-dependent riboflavin kinase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 54-127
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000126
Family MarR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781665|ref|YP_006546137.1|
Sequence length 263
Comment riboflavin kinase, archaea type [Methanoculleus bourgensis MS2]
Sequence
MQVRLTPGLIKLAYQTSTFHEDRRSGIVAQPVYSMHLNYGTMVEAEDLQSLKTIALLGGC
KGPIWLSSQSLGNELGISPQTASRRLIALERQQFIIRSMKPDGQHVAVTRAGEQELRREY
ADYIRIFNPKRKQYSLTGTVISGLGEGRYYMSIPHYKEQFGKHLDFEPFPGTLNIRLDPA
SIQVRKQLEHIGWIEVPGFTADERTFGGVRTLPCRIRGEVCAIVEPSRTHYPEDIIEVIA
GCELRKALDLNDNDMIEVEITYD
Download sequence
Identical sequences I7LKX8
WP_014868393.1.51038 gi|397781665|ref|YP_006546137.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]