SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397781715|ref|YP_006546188.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781715|ref|YP_006546188.1|
Domain Number 1 Region: 10-288
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 7.19e-38
Family SGL-like 0.049
Further Details:      
 
Weak hits

Sequence:  gi|397781715|ref|YP_006546188.1|
Domain Number - Region: 530-613
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0515
Family I set domains 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781715|ref|YP_006546188.1|
Sequence length 1103
Comment Tripartite motif-containing protein 71 [Methanoculleus bourgensis MS2]
Sequence
MIGKYGLFIVFSLLAVLACPPVLASELGEYELIATWGSLGADDGRFNRPTGIAVDAEGNV
YVADYCDRIQKFDSTGAFLLQWGSSGSGDGEFYQPDNIALDADGKVYVVDYYRIQVFDSN
GTFLKKWGSYGTGEEQLQYPQSIAFDADGNAYVIAGGGIKKFDSDGNFLTSWGGFGTYDG
EFHNAVDVVVDAAGNVYVADCYNNRIQMFNSTGAFLLKWQVGYPYGITVDSAGDVLVAAS
STSVLKFDSFGNLLARSLGGSGKDITVGADGTVYVTSDHCVRVFKQSSAPTPTPTVPKGL
GITSNKDSVIRGNSFTVTITGESAKAYHLFIKPEESLADSDYPWIVAGQNGVSTVGMINP
ERNATVMTTAGGTRSIQFNTNRSTDAQTFTIRVEDPADPTTYDDVKVKIQEGAVTITTYG
GTRYLGEEVTLYGINTDSETTYLFLTGSDLAASGVKLSDIKVAVEDGNPGTFTCVHVEAD
DTWSYMWNTADIGRRLNASNYTVYAAAEPRSRDNLSDAKYGATDIQLKLPSIKVTTSRAT
VARGDALAIDGTVTGRPDSVQIWIIGPDYLSLGVPIVLRNEYSSSNHFTYLLTGTETSNL
TLGQYFVVVQHPVVNGFGVTANGTTISGPGVTPTDLAGLQPSEAANALISALESPHVDDT
YAKLTFTVGAPMIRIDPIERTDKINWFGNIDLISWFDWLSTWTCGETFTITGTTCYPAGT
TLAYTITSRKNGAHIFSGDIIVTDGGEWGFDVNTAAIGPGEYIVRVMSLDDQSSASASFT
VRDGVVNPVPPAGATYRVERISVNPSLGDLAPGGRATLNGIINAPWAGCQEDLGFSTDLL
VPAWSYAIEVEREVIRSGSQNAGSFMLSAFELDYDEEDVRVLLHLSGTVPGTGAEDPALL
RIFQRDASGGTVPDSEYSLPFTPSGNDPVQPFGDNLTLSPGWNFISVPRPLAAGNDTAMI
FSGINTTGRSVLRYNTTIRDWTQLDKEDRIAPLEGLWIYSAGPATVPLSFSTDPLLPPAE
RILAAGWNAVGTTGTTPATARDTLYSVNAQWTTLIGYDARTQAFESGIVNGGSGANADTR
LVYPGKGYWLSMSGPGTLYAIGA
Download sequence
Identical sequences I7LKZ8
gi|397781715|ref|YP_006546188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]