SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781719|ref|YP_006546192.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781719|ref|YP_006546192.1|
Domain Number 1 Region: 432-531
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000128
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397781719|ref|YP_006546192.1|
Sequence length 535
Comment sulphate transporter [Methanoculleus bourgensis MS2]
Sequence
MPARKQRWRRSLPADLMAGATTALVGIPQAMGFAIVAGVNPVYGLYAATFATAIGALLTG
SSYLKVMLSNILAVSIYSVLAPIPEADIPATLFVLTLLVGIFQLGFGLVRAGSLTGFISN
AVLTGFIIGGALLIILGQLGNLTGYELERGGIRIFAAADLLRHTAEINPQALAVGLLTTG
LVLAFRRVPHLRTAALLLPIIIATLIVRAAEIEVALVSDISAIPAGLPAPVIPDLALAPG
LLVPALALAILGLVMAVGVTEKTPEPDGTIADVNQDFRGQGITNILTSLFQCAPASGSLS
ATALNVSAGAETRAANLFSGVIVGLLILLAGPLAELIPLPALAGLLILIGAELMYRPHEI
ACIWKYSRSGRWAMVATFLSTQVLPLQYSIYIGVFLSLAIYLVTSTRGASVVRLVPVGEG
MFREERAPDRLPEGQVTVLSISGNVFFATLQAIERSLPSPEGARGAVVIFALRGQVEAGT
GLFRMLERYARQVHAHGSRLILAEVDPGLLAGLSETGATPVIGESIFEAIRAADR
Download sequence
Identical sequences I7KE55
WP_014868447.1.51038 gi|397781719|ref|YP_006546192.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]