SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781767|ref|YP_006546240.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781767|ref|YP_006546240.1|
Domain Number 1 Region: 63-133
Classification Level Classification E-value
Superfamily Iron-dependent repressor protein, dimerization domain 1.37e-16
Family Iron-dependent repressor protein, dimerization domain 0.0032
Further Details:      
 
Domain Number 2 Region: 5-62
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000125
Family Iron-dependent repressor protein 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397781767|ref|YP_006546240.1|
Sequence length 141
Comment DtxR family iron dependent repressor [Methanoculleus bourgensis MS2]
Sequence
MRRKTKEEYIEIICLLEREQGRAQTGMIAEAIDVKPPSVTEMLRKLEEKGLIIYEPYAGA
TLTPAGLEMARDLRQRHRTFADLLGLLGVDAGTAEADACQFEHHVSPETLEHLGLFLEFL
RESPEGRQSLEDFREFRRRRG
Download sequence
Identical sequences A0A0X8XZ28 I7LNZ4
WP_014868495.1.51038 WP_014868495.1.63524 gi|397781767|ref|YP_006546240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]