SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781772|ref|YP_006546245.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781772|ref|YP_006546245.1|
Domain Number 1 Region: 177-305
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.84e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.037
Further Details:      
 
Domain Number 2 Region: 426-550
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.24e-22
Family PYP-like 0.087
Further Details:      
 
Domain Number 3 Region: 304-428
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.18e-17
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 4 Region: 79-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.72e-16
Family Flavin-binding PAS domain 0.086
Further Details:      
 
Domain Number 5 Region: 11-66
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000716
Family GntR-like transcriptional regulators 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781772|ref|YP_006546245.1|
Sequence length 558
Comment PAS/PAC sensor protein [Methanoculleus bourgensis MS2]
Sequence
MEPNTDALSPLLRVLKEHPRGMSVSDLAAAVGVNRNTVSRYLDVLLVSGRVEMETYGKAK
VFYLSQRVPISAMLNFSSDLVLVLDRDRRIIQANDAVCAFAGVERDNIIGKSVEESQLAA
FDHPLIQGRITDALNGSEVVEELRFLRHAEELFFKVKFLPTVFNDGTPGVTIILEDITEG
RRAEEALRESETLFRSLVENINDLILNVDETCAFTYVSPKSREILGYAPGEMLGKTPCDF
MAPGKAERVRAQLAALLADPKPRILFEWTMLHHDGSSVTLEVSGTPIYDMIGSFTGYRVV
CRDITERVRATKLLAQWKSFLYSVVNNIPSMVFVRGVEGETFVFSNQAAETFLGMTKEEI
AGKQAKDLFPPEMAAFFADGNQEVLERSAVREEQVRLPDGRILSMKKIPIFNSRGMLKYM
LGIAEDVTNRAAAEDRLVAERDRAQGYLNAAGVMIAVIEADGTINLVNQRGYEILGYTGE
DLTGKNWFSTIVPERLRDRLTRNFARLVAGEIEPPPYEKGPVVTRDGRERQILWHNALLR
DTDGKVVAMVSSGEEVTE
Download sequence
Identical sequences I7LNZ6
WP_014868500.1.51038 gi|397781772|ref|YP_006546245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]