SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397781302|ref|YP_006545775.1| from Methanoculleus bourgensis MS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397781302|ref|YP_006545775.1|
Domain Number 1 Region: 413-632
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.77e-42
Family SGL-like 0.025
Further Details:      
 
Domain Number 2 Region: 72-304
Classification Level Classification E-value
Superfamily NHL repeat 1.41e-40
Family NHL repeat 0.00014
Further Details:      
 
Domain Number 3 Region: 620-711
Classification Level Classification E-value
Superfamily PKD domain 3.92e-26
Family PKD domain 0.00046
Further Details:      
 
Domain Number 4 Region: 267-403
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000000000118
Family All0351-like 0.063
Further Details:      
 
Domain Number 5 Region: 710-777
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000981
Family Type I dockerin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397781302|ref|YP_006545775.1|
Sequence length 786
Comment Tripartite motif-containing protein 71 [Methanoculleus bourgensis MS2]
Sequence
MDVMTMKQMIFLVVVVLAAMVPAALASDEYLVEQADPPVVPLPSDTPSLLNVQQDSGTPE
YTLVMKWGTKAYTEDGAFDTPKGVAVDAAGNVYVADRGNNRIQKFDSDGNLLAKWGSHGK
GDGEFRQPSSIAVDAAGNVYVTDVGNNRIQIFDSAGNFLMKWEPCGTGDAEFWGVCSIAV
DVSGNIYVVNEDDYYIQKFDRSGKLLTKWGSRGTGEEPWEVAGIAVDDSGNIYATDWRHR
CIQKFNSSGNFLTKWELHGLDDAVYVAPTGIAVDTSGNVYVYDVSYIQKFDSSGNFLAQR
ESGGWVDGRFLPSSSAAGIAVDATGNIYVANKDHCCIQKFDSSGKFTTWGFKDSRDGEFL
RPFDIAVDAAGNVYVADEIHTCIHPCIHKFDSSGKFLTRWGIRGSGNGMFWKVAGIAADD
SGNVYVTDCHSPRIQKFDSAGNFLMKWGSYGTGDGEILGASGIKTDASGNVYVADPGNGR
IQKFNSAGNFLMKWGSYGTGNGEFMWPKGIAVDASGNIYVTDYHSSHIQKFDSAGNFLTK
WGSYGRGDGEFRNPSGVAIDAAGNVYVADKENHRIQKFDSDGTPLTKWGSYGGGDGEFRQ
PSGVAVDAAGNVYVADRGNGRIQMFAPRAPAPVAAFTANITTGTAPLTVRFTDESIGDPK
SWAWSFGDGGTSDQQHPTHAYTAPGNYTVALSVDDGLSTATKPDSIKVTPVLFGDANGDG
EVNQADTLRVLQQVVGIVEPDKMPKPGTEEFQRTDVNQNGVIEVGDALFIAQYNVGLRDV
WFELLE
Download sequence
Identical sequences I7LNG1
gi|397781302|ref|YP_006545775.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]