SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386001201|ref|YP_005919500.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001201|ref|YP_005919500.1|
Domain Number 1 Region: 186-433
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.46e-127
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000005
Further Details:      
 
Domain Number 2 Region: 1-185
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.73e-76
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386001201|ref|YP_005919500.1|
Sequence length 434
Comment Methyl-coenzyme M reductase, beta subunit [Methanosaeta harundinacea 6Ac]
Sequence
MSDKIDLYSDRGVLLKSDVDLSAVSPLKNAAMKKLINLTKRTVAVNLAGIENALKTGKVG
GQGRQIKGRELKYDVVANANALAAEIKKLLQVEAGDDTNVQVLGGGKQLLVQIPTARVDA
ASEFVVGMTATAAATCEALVTQFKAGMFEAPMVHAAVWGQYPQTVPMAGGNIASVLNIPQ
NDEGLGFALRNIMANHIAAITKRNAMNAAALSSIYEQIGNFEMGNAIGIFERYQMLGLAY
QGLNANNMVYDLVKSNGKTGTIGTVVHSVVERAVEDKVIKAGEKLPSGFVMYEAVDVPMW
NAYCAAGTLAATMVNCGALRGAQAVSSTLLYFNDVIEKETALPGCDWGKVMGTAVGFSFF
SHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVSAAVALDAGTQMFTPEMTSGLVGAVYGEI
KEFREPIVAVAEAV
Download sequence
Identical sequences E5KJV4 G7WN21
WP_014586062.1.3402 gi|386001201|ref|YP_005919500.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]