SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386001217|ref|YP_005919516.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001217|ref|YP_005919516.1|
Domain Number 1 Region: 237-316
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000113
Family I set domains 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386001217|ref|YP_005919516.1|
Sequence length 328
Comment Peptidase S8 and S53 subtilisin kexin sedolisin [Methanosaeta harundinacea 6Ac]
Sequence
MKAIKLSMAVLIIGLFLASPSLGVASSPFGEGWPLWNDGVGIGDSQVKGISKADETTYQE
NASTADVLKDAPLAEEASADAESSEGYDAVVDDWIIDESFYSDSSGYEGEEFGWGDTIDH
PGMPGPDENALWIVFPYSTNVRTTKLVIQRGRFAKELIIPGMDGKLTIHEVRPDGTEDTY
VPDWQVKARRAYRVWFTADSVGDYTVWYEVQNPKTMVTTKSNEIKYRVFENLAIVVPNEV
KCEGETATLRALVSGCYDPIYQWFKGITSEDGTSIPGATGSVYIIRNVSPEDEGYYTCKV
TCNGNSDEDAGYLRVCTRDEEGNKCKGR
Download sequence
Identical sequences G7WN37
gi|386001217|ref|YP_005919516.1| WP_014586078.1.3402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]