SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386001297|ref|YP_005919596.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001297|ref|YP_005919596.1|
Domain Number 1 Region: 28-141
Classification Level Classification E-value
Superfamily NHL repeat 3.92e-16
Family NHL repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386001297|ref|YP_005919596.1|
Sequence length 142
Comment hypothetical protein Mhar_0595 [Methanosaeta harundinacea 6Ac]
Sequence
MGAKISILFVISILASILPVCGGPLLAQWSLEDLVGGIAIGPGGEVYVTINNSHKVVKYS
PEGERLAEWDVDGVIETNGIAVGPGGEVYVTINNNHKVVKYSSEGEKLDEWAVDGMMNGI
AAGPNGLIYISFTNRMIQVFWA
Download sequence
Identical sequences G7WNJ7
gi|386001297|ref|YP_005919596.1| WP_014586158.1.3402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]