SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386001482|ref|YP_005919781.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001482|ref|YP_005919781.1|
Domain Number 1 Region: 271-383
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000000222
Family Collagen-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  gi|386001482|ref|YP_005919781.1|
Domain Number - Region: 135-248
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000759
Family Collagen-binding domain 0.015
Further Details:      
 
Domain Number - Region: 56-131
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00209
Family Collagen-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386001482|ref|YP_005919781.1|
Sequence length 393
Comment hypothetical protein Mhar_0785 [Methanosaeta harundinacea 6Ac]
Sequence
MKAKLMAILAILLLSGGISIASAEDQAPDVAGAHPATDLGVIGAGGEAISSRADLAYPGE
IDWFKFAVETPTAELVISSDMTKALRFVLYDESLEYIDHGEDLLRMTADAGTYLLRVDSI
LSQTGNYTVSISNVISEAEPNDCITEGNILGPLANTTILSGSIDPLADTDFFLFEIGPDS
EGYLKVTSETYEVDEEDEEEYDLWSYSDYLSLVLYGFNESEGRYMPIESGDGEMAADLSA
GRYALRAQSGSSDPISGYVITLSLQDLECDDEPNDSPQDALELGVLTGGGELTASGCIIP
GDDVDYYLLVLEEAMEVVVETSGDDRGDSYLYLYDDLEEEIDYDDDSGEDSWSRIEEELS
AGTYYIKVASFWSGDSFQYTLKVAGTGSEEKGE
Download sequence
Identical sequences G7WKX5
WP_014586343.1.3402 gi|386001482|ref|YP_005919781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]