SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386001689|ref|YP_005919988.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001689|ref|YP_005919988.1|
Domain Number 1 Region: 16-104
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.97e-17
Family Ferredoxin reductase FAD-binding domain-like 0.005
Further Details:      
 
Domain Number 2 Region: 101-260
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.0000000000000921
Family Flavohemoglobin, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386001689|ref|YP_005919988.1|
Sequence length 310
Comment Sulfide dehydrogenase (Flavoprotein) subunit SudB [Methanosaeta harundinacea 6Ac]
Sequence
MEETICERSVGSIANEIVRKETVAPGFTLMEIRAPDIAEKIQAGQFMILRVDEAGERIPM
SVADWDRERGTVTLVFQELGLSTKKLGLMEPGQRLANLAGPLGKAAEVGHFGTVAIVSGC
FGTGPGYALAKALKGAGNRVIYIAEAFRGEFHFWLDRLAEVADRLIVASGDMTVGSARWA
KDPLRDLLESEEIGRVYLIGCTFMMATCSRASEPFGVETRASLMPIMIDGTGMCGACRVN
VAGETKLACVEGPEFAGRDVDWSELMERARGYLKEEERALDLWEIDNWHLVRFRDRGPEE
RRKRGGPRRC
Download sequence
Identical sequences G7WLZ0
WP_014586550.1.3402 gi|386001689|ref|YP_005919988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]