SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386002130|ref|YP_005920429.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386002130|ref|YP_005920429.1|
Domain Number 1 Region: 81-235
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.31e-29
Family Dihydroorotate dehydrogenase B, PyrK subunit 0.00092
Further Details:      
 
Domain Number 2 Region: 2-86
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.47e-16
Family Ferredoxin reductase FAD-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386002130|ref|YP_005920429.1|
Sequence length 256
Comment Oxidoreductase FAD/NAD [Methanosaeta harundinacea 6Ac]
Sequence
MRPISARIVEIVQETPTVRSLRFDRSLGPVPGQYLMVWVRGIDEVPMSFSYRDGITVQLV
GEATRAIFDLEVGGSLGLRGPLGNGFTLSGERILLVGGGVGAAPLALLGEAAAEAGIEVT
TLLASRCCDDLLFLKRFERIGEVVITTDDGSLGICGRASAGLSALQLQEFDQIYLCGPEP
MMADVIGRCAGMETKIQASIDRYFKCGMGICGSCSLDPSGIRVCVEGPVFRADRLAGTEF
GRYRRGASGIKLLRDG
Download sequence
Identical sequences G7WKH9
WP_014586990.1.3402 gi|386002130|ref|YP_005920429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]