SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386002158|ref|YP_005920457.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386002158|ref|YP_005920457.1|
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 2.75e-105
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.00000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386002158|ref|YP_005920457.1|
Sequence length 274
Comment F420-dependent methylenetetrahydromethanopterin dehydrogenase [Methanosaeta harundinacea 6Ac]
Sequence
MFKIGFIKLGNVASSLVADLALDEIAERTDVEVRSLSFGAKMTVKEAEMSAELKGWGPQL
VVIVGPNAATPGPTAARALYRDVPTIVISDGPSKKEAREALEAEGFGYIILPFDPLIGAK
REFLDPAEMALFNSDALKVLSICGSVRLVQEELDGAMASIISGAPRLPTILSSPEGCTDR
MAFRNPYARAKAIGALHMAQTVAGIDAAACFRLKELDRIALTAAAGHEVMRAAARLADEA
RELEKSTDSVSRRPHARSGAILAKTGLLDKPEPV
Download sequence
Identical sequences G7WNZ3
WP_014587018.1.3402 gi|386002158|ref|YP_005920457.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]