SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386002426|ref|YP_005920725.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|386002426|ref|YP_005920725.1|
Domain Number - Region: 88-152
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000486
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386002426|ref|YP_005920725.1|
Sequence length 156
Comment hypothetical protein Mhar_1744 [Methanosaeta harundinacea 6Ac]
Sequence
MEGGEEMVSRRRADGDPGGGEGDEGQIGGYWKRFLFGIAVMAVIFTGLLLAIDHLGLVAP
AGDGADLPPRIELFEAVPDSVRPGEGTVLRWRVSGVSLADEVRIEPGIGAVAREGRLAVQ
PEETTVYTLTAINAAGEDEARATVEVAGAEQPALSP
Download sequence
Identical sequences G7WQV9
gi|386002426|ref|YP_005920725.1| WP_014587283.1.3402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]