SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386001281|ref|YP_005919580.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001281|ref|YP_005919580.1|
Domain Number 1 Region: 214-320
Classification Level Classification E-value
Superfamily SIS domain 4.45e-17
Family mono-SIS domain 0.0031
Further Details:      
 
Domain Number 2 Region: 27-138
Classification Level Classification E-value
Superfamily SIS domain 0.0000000334
Family mono-SIS domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386001281|ref|YP_005919580.1|
Sequence length 396
Comment Sugar phosphate isomerase involved in capsule formation-like protein [Methanosaeta harundinacea 6Ac]
Sequence
MAGLFDTYKDATALQCSFVEKLTRLDLESVNGFADSLASFLRSKDEKNFVYGLAAGRSAL
SLYSFLQLLYNHFNAFPCTMEDPVQKHFRSTRKNLGIAVSGSGETPAVNKYIEDIINQGG
DITLITANEDGTAHQLVERYENGSVLVIKGKTKYDLDLTRTSKLSPMGTEFELEVLAFLN
AVFKEVQSRIEGEESGDCQRYLSTIKDFAGQCHLISKVDEGRLTRWFERLFPRNGRYIIG
GVGRSGLVARAFEMRFTHLNKTSYWERDFNTPSFQIGDVYVPITGSGNTYECLEGVRSAF
KRGADVLPITTNPTSELVELMAERGREEDIAFIPVSEEYLDQICGSRRTTSWLVSEYSMH
RYPIFEINASIFTNSVVAVGAEFLGIEEAGMKRLHA
Download sequence
Identical sequences G7WNI1
WP_014586142.1.3402 gi|386001281|ref|YP_005919580.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]