SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386001728|ref|YP_005920027.1| from Methanosaeta harundinacea 6Ac

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386001728|ref|YP_005920027.1|
Domain Number 1 Region: 87-391
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 1.53e-45
Family TM0189-like 0.084
Further Details:      
 
Weak hits

Sequence:  gi|386001728|ref|YP_005920027.1|
Domain Number - Region: 25-81
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000128
Family Type I dockerin domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386001728|ref|YP_005920027.1|
Sequence length 425
Comment Periplasmic binding protein [Methanosaeta harundinacea 6Ac]
Sequence
MKGKMLASILALCLMVGISAADFTLHIYGNANMDDVIDERDIEYARGIIDGTERMTDLAD
VNGDGNVDEEDIRLTEEIIDGTAAEIKVIDSDGNSVSVKVPVERIVIYNHQCAEILQILN
ADDRVAGVRDTFETQENRFPQISKKKNIGSGVDLDIEAIISVDPDLIIAYTFYPTKEDLE
AELPSKIPILRIDCAGGGPCGIDSIRDGVSILGYLLDARDEAARYQEWHDRYVGPVEART
SAIPEGERVRVYLESTPEGSETISSRTAIGKNHPAGNLIELAGGVNIAAGHLPLYMDTDN
EYGEIETEWVLEENPEVIVGRAMGAGVRPYENEDDSLLRAYSDQIKGLPGFDGVDAVKND
RVYIITNDHAVTPNYPSALLLLAKWFYPEIFQDLNPREAHLEYLEMMGISKEVASKNTYY
YPAVA
Download sequence
Identical sequences G7WM29
gi|386001728|ref|YP_005920027.1| WP_014586589.1.3402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]