SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336476194|ref|YP_004615335.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336476194|ref|YP_004615335.1|
Domain Number 1 Region: 1-277
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 9.29e-118
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336476194|ref|YP_004615335.1|
Sequence length 278
Comment Methylenetetrahydromethanopterin dehydrogenase [Methanosalsum zhilinae DSM 4017]
Sequence
MAKIGFIKLGNLGISQVIELVQDEIAAREGISIRVFGTGPKMGKDEAASTEQFKDMSWDA
DFYVIISPNASAPGPTAAREIWKDVPCIIVSDGPTKKDDRQALEEAGFGYIILKVDPLIG
AKTEFLDSVEMASFNSDAMKVLSTCGVVRLIQEELDKVVEQVDAGKSGSDIELPHILAKP
EVCVERAGFENPYAKAKALASLFMAEKVAQINFPACFMMKELEDVALTTATGHEMMRAAA
ELAVQAREIEKINDTVSRHPHSKKGKVLSKTRLFEKPA
Download sequence
Identical sequences F7XNL9
WP_013897555.1.3471 gi|336476194|ref|YP_004615335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]