SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336476878|ref|YP_004616019.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336476878|ref|YP_004616019.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.81e-32
Family Sfri0576-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336476878|ref|YP_004616019.1|
Sequence length 120
Comment hypothetical protein [Methanosalsum zhilinae DSM 4017]
Sequence
MIEIIEDLPENVVGVTASGVVKEEDYDKILKPLIEDKIQKHEKICFLYHLDENFDKFTRE
ALLEDAKVGKEYFTSFEKIAVVSDKDWLLNTVEIFKFVIPASVKTFSNEELADAKAWVSE
Download sequence
Identical sequences F7XLD9
gi|336476878|ref|YP_004616019.1| WP_013898239.1.3471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]