SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336477047|ref|YP_004616188.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336477047|ref|YP_004616188.1|
Domain Number 1 Region: 69-195
Classification Level Classification E-value
Superfamily Ferritin-like 0.00000000000000702
Family Ferritin 0.042
Further Details:      
 
Domain Number 2 Region: 16-49
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.000000188
Family Rubredoxin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336477047|ref|YP_004616188.1|
Sequence length 196
Comment hypothetical protein [Methanosalsum zhilinae DSM 4017]
Sequence
MDLLIDRSNKGAGHMTDEVQVFRCRICGDPYIGTDKPDRCPFCGAMTKYIIEADRWDSAE
FEVELSITSRKNLESALELEVSNAGFYICAMEEAVSKEDEYNLAKFKALKKVEAEHASAI
CKFLKIAVPKIDKLECSKDSIENTKEGWERERRAIDSYSRFADEAVEPRIKEFFTALIEI
ETDHLDLHSNMLKNVN
Download sequence
Identical sequences F7XM80
WP_013898406.1.3471 gi|336477047|ref|YP_004616188.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]