SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336477072|ref|YP_004616213.1| from Methanosalsum zhilinae DSM 4017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336477072|ref|YP_004616213.1|
Domain Number 1 Region: 92-262
Classification Level Classification E-value
Superfamily Rhomboid-like 5.23e-41
Family Rhomboid-like 0.00095
Further Details:      
 
Domain Number 2 Region: 2-45
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000000085
Family AN1-like Zinc finger 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336477072|ref|YP_004616213.1|
Sequence length 276
Comment rhomboid family protein [Methanosalsum zhilinae DSM 4017]
Sequence
MSKECWICGKKDIFPYKCRYCGKEFCSDHRLPERHACEGLESMKRGSWNKKKSQPEDLFN
DVLKQASVQVGKSAIKGITMTIKKSLTSSPSMTIIAICIISFILGIIPGYFDLFKFDPTQ
ILAKPWAIITYMFLHAGVAHLFFNMLVLFFFGRELERRVGNTMFLKVFFISGIVAALGYS
LTSDISMVGASGAIYGVFAAVALLAPDLRIYIYFFPMKIKYALVIFAAIDFLLISAPTMI
AHSAHLMGLFTGLLMGYYIKKANKEIKYRKRGYYHR
Download sequence
Identical sequences F7XMA2
gi|336477072|ref|YP_004616213.1| WP_013898431.1.3471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]