SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336121680|ref|YP_004576455.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|336121680|ref|YP_004576455.1|
Domain Number - Region: 54-86
Classification Level Classification E-value
Superfamily vWA-like 0.0534
Family Integrin A (or I) domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336121680|ref|YP_004576455.1|
Sequence length 112
Comment hypothetical protein Metok_0700 [Methanothermococcus okinawensis IH1]
Sequence
MLKVKLNNKIYHLNVADNFIKRAFGLMFRDIGHDEGLIFYYHKRKLHIHTCFMKYPIDVV
FLMDNSVVGIVKNLKPWKTYKSNVYSNAMIEIKSCGLDLKIGDKLNIIDEKE
Download sequence
Identical sequences F8AM02
WP_013866863.1.9613 gi|336121680|ref|YP_004576455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]