SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336121692|ref|YP_004576467.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336121692|ref|YP_004576467.1|
Domain Number 1 Region: 11-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.46e-22
Family Transcription factor E/IIe-alpha, N-terminal domain 0.0027
Further Details:      
 
Weak hits

Sequence:  gi|336121692|ref|YP_004576467.1|
Domain Number - Region: 114-150
Classification Level Classification E-value
Superfamily RING/U-box 0.00459
Family IBR domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336121692|ref|YP_004576467.1|
Sequence length 199
Comment transcription factor E [Methanothermococcus okinawensis IH1]
Sequence
MKLNKEDIYNMLDNPLVQQVLLEILNDDTSGFDVLAVLIELEEVTDDEISRQLDLKLNTV
RKLLYKLYDARLVDYDREKDEETNWYTYTWKPALEKLPSLVRKKTQHVLKELKEQLIVEE
NNMFFYCPNCEFKYTFEEAMDYGFRCPQCGGILKEYNNKNDIKIIKEQIKFLEDELRLNP
LFSTSEGIKNQKRDKVAVV
Download sequence
Identical sequences F8AM13
WP_013866875.1.9613 gi|336121692|ref|YP_004576467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]