SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|336121364|ref|YP_004576139.1| from Methanothermococcus okinawensis IH1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336121364|ref|YP_004576139.1|
Domain Number 1 Region: 364-401
Classification Level Classification E-value
Superfamily RING/U-box 0.0000953
Family RING finger domain, C3HC4 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|336121364|ref|YP_004576139.1|
Sequence length 428
Comment hypothetical protein Metok_0372 [Methanothermococcus okinawensis IH1]
Sequence
MSSERRIVIDRVYLTMDIPFLYSKLGNSFNKKVYERLKEEFPQFLQRVSEGRGKRGDFHF
RVPVEVWSEDDIEKSLDGREIASLSISLRSPYRARGYFNVNRLFMKEHGLNPYQDSYKDD
NVLPIDVLEDENDSLLREFCRLFVDRLEHFKIEYVYYLKKLFGIDIFDIFRGYDISELVR
LSVQSAEVCVEWLHCESLQFRHITDERKHNYLKVYGDLTQTEYYTPDKKSVHIQWKRYQK
GAGINRHEFTWNSEVSRMWLSGDVDYLVNSVKYGIEQSYRLFGFDFKTLKPLPLTCEDVI
QDYAEWWKLPLDLVKTILFGRAYVLSFDFHTKGLRERLKSRRLIVPLEKELGGKKGLWRW
SDTVQRIRLSLQGYYRCPKCGSIMRYSDKCFKHVCEHCGYEIDYSRFTLGSEDSQKEYES
MLLSFKKV
Download sequence
Identical sequences F8AKM8
WP_013866547.1.9613 gi|336121364|ref|YP_004576139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]