SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|479150098|ref|YP_007780274.1| from Ruminococcus bromii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479150098|ref|YP_007780274.1|
Domain Number 1 Region: 143-312,360-522
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.07e-74
Family YicI catalytic domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 31-141
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.66e-16
Family YicI N-terminal domain-like 0.0033
Further Details:      
 
Domain Number 3 Region: 526-608
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000000453
Family Putative glucosidase YicI, domain 3 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479150098|ref|YP_007780274.1|
Sequence length 634
Comment Alpha-glucosidases, family 31 of glycosyl hydrolases [Ruminococcus bromii L2-63]
Sequence
MIKKFTSGNPIDTQAVVEKFNALPIAEFPLGGKFENGNFVFEFDMADSDIVYGLGEAPRG
INKRGWVYNSFCSDDPFHTETKSSLYAAHNFLMLSGSKTFGIFIDFPSKIRWDIGYTTAN
KTVITIDGTDFDIYYIDGTKPLEIVKEFRKSIGTSYVPPFWAFGYQQSRWSYYDAEAVDA
VVDGYNKAGIPLDCVYLDIDYMERYKDFTVDDEKFPNFKDYVSKKREEGIHLIPIIDAGV
KKENGYDIYEEGRKNGYFCKNEDGTDFEGGVWPGIVGFPDFLRPDVRKWFGSKYKILTDM
GIDGFWNDMNEPAIFYSVKGLNKALDKAASLKGQNLDLSKFFELKDTFAGLSNSPEDYSS
IYHTVDGKQVCHDQVHNIYGANMTKAAGEYFAEEFGKEKILMFSRASYVGAHRSSGIWFG
DNHSWWSHILLDLKMLPSANMCGFLYCGADLGGFNENATRDLVLRFLALGVFTPLMRNHA
ALGTRNQECYSFENSDDFKDIVEVRYRLIPYLYRTFKKASEENDMIFRPLSFDYPDDKIA
RECETQLMLGDECMICPVYEQNVGGRYVYLPENMTFVKLSGTSVTTEKMSKGTHYIEVAL
NEVPLFVKDGRQIELCKPAMRTSQLDTTDTVMIP
Download sequence
Identical sequences D4L4F2
gi|479150098|ref|YP_007780274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]